Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries) |
Domain d4irja1: 4irj A:7-185 [252684] Other proteins in same PDB: d4irja2, d4irjb_, d4irjc1, d4irjc2, d4irjd1, d4irjd2 automated match to d3hujc1 complexed with 1l9, nag |
PDB Entry: 4irj (more details), 3 Å
SCOPe Domain Sequences for d4irja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irja1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d4irja1: