Lineage for d4iqwa3 (4iqw A:303-510)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3006901Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 3007143Protein automated matches [254484] (3 species)
    not a true protein
  7. 3007149Species Mouse (Mus musculus) [TaxId:10090] [256295] (30 PDB entries)
  8. 3007169Domain d4iqwa3: 4iqw A:303-510 [252683]
    Other proteins in same PDB: d4iqwa1, d4iqwa2
    automated match to d1jmsa4
    protein/DNA complex; complexed with 1fq, na

Details for d4iqwa3

PDB Entry: 4iqw (more details), 2.6 Å

PDB Description: tdt core in complex with inhibitor (2z,5e)-6-[4-(4-fluorobenzoyl)-1h- pyrrol-2-yl]-2-hydroxy-4-oxohexa-2,5-dienoic acid and ssdna
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4iqwa3:

Sequence, based on SEQRES records: (download)

>d4iqwa3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaadhfqkcflilkldhgrvhseksgq
qegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtk
rvfleaeseeeifahlgldyiepwerna

Sequence, based on observed residues (ATOM records): (download)

>d4iqwa3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkdaadhfqkcflilkldhgrvhsekegkg
wkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtkrvfle
aeseeeifahlgldyiepwerna

SCOPe Domain Coordinates for d4iqwa3:

Click to download the PDB-style file with coordinates for d4iqwa3.
(The format of our PDB-style files is described here.)

Timeline for d4iqwa3: