SCOPe 2.05: Domain d4iqwa2: 4iqw A:243-302

Lineage for d4iqwa2 (4iqw A:243-302)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.0: automated matches [254215] (1 protein)
   not a true family

6. Protein automated matches [254483] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255237] (29 PDB entries)

8. Domain d4iqwa2: 4iqw A:243-302 [252682]
   Other proteins in same PDB: d4iqwa1, d4iqwa3
   automated match to d1jmsa3
   protein/DNA complex; complexed with 1fq, na

Details for d4iqwa2

PDB Entry: 4iqw, 2.6 Å

PDB Description: tdt core in complex with inhibitor (2z,5e)-6-[4-(4-fluorobenzoyl)-1h- pyrrol-2-yl]-2-hydroxy-4-oxohexa-2,5-dienoic acid and ssdna

PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4iqwa2:

Sequence; same for both SEQRES and ATOM records:

>d4iqwa2 a.60.12.0 (A:243-302) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

Timeline for d4iqwa2:

• d4iqwa2 first appeared in SCOPe 2.04
  
• d4iqwa2 appears in SCOPe 2.06
  
• d4iqwa2 appears in the current release, SCOPe 2.08