Lineage for d4iqva3 (4iqv A:303-510)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2612791Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2613033Protein automated matches [254484] (3 species)
    not a true protein
  7. 2613039Species Mouse (Mus musculus) [TaxId:10090] [256295] (30 PDB entries)
  8. 2613069Domain d4iqva3: 4iqv A:303-510 [252680]
    Other proteins in same PDB: d4iqva1, d4iqva2
    automated match to d1jmsa4
    protein/DNA complex; complexed with 1fo, na

Details for d4iqva3

PDB Entry: 4iqv (more details), 2.9 Å

PDB Description: tdt core in complex with inhibitor 6-[4-(3-fluorobenzoyl)-1h-pyrrol-2- yl]-2-hydroxy-4-oxohexa-2,5-dienoic acid and ssdna
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4iqva3:

Sequence, based on SEQRES records: (download)

>d4iqva3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaadhfqkcflilkldhgrvhseksgq
qegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtk
rvfleaeseeeifahlgldyiepwerna

Sequence, based on observed residues (ATOM records): (download)

>d4iqva3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaadhfqkcflilkldhgrvhsekegk
gwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtkrvfl
eaeseeeifahlgldyiepwerna

SCOPe Domain Coordinates for d4iqva3:

Click to download the PDB-style file with coordinates for d4iqva3.
(The format of our PDB-style files is described here.)

Timeline for d4iqva3: