Lineage for d1d8lb2 (1d8l B:1-64)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59474Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
  6. 59475Protein DNA helicase RuvA subunit, N-terminal domain [50260] (2 species)
  7. 59476Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)
  8. 59480Domain d1d8lb2: 1d8l B:1-64 [25268]
    Other proteins in same PDB: d1d8la1, d1d8lb1

Details for d1d8lb2

PDB Entry: 1d8l (more details), 2.5 Å

PDB Description: e. coli holliday junction binding protein ruva nh2 region lacking domain iii

SCOP Domain Sequences for d1d8lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8lb2 b.40.4.2 (B:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

SCOP Domain Coordinates for d1d8lb2:

Click to download the PDB-style file with coordinates for d1d8lb2.
(The format of our PDB-style files is described here.)

Timeline for d1d8lb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d8lb1