Lineage for d4iqva1 (4iqv A:148-242)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329042Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329269Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 2329270Protein automated matches [254482] (3 species)
    not a true protein
  7. 2329289Species Mouse (Mus musculus) [TaxId:10090] [255236] (31 PDB entries)
  8. 2329321Domain d4iqva1: 4iqv A:148-242 [252678]
    Other proteins in same PDB: d4iqva2, d4iqva3
    automated match to d1jmsa1
    protein/DNA complex; complexed with 1fo, na

Details for d4iqva1

PDB Entry: 4iqv (more details), 2.9 Å

PDB Description: tdt core in complex with inhibitor 6-[4-(3-fluorobenzoyl)-1h-pyrrol-2- yl]-2-hydroxy-4-oxohexa-2,5-dienoic acid and ssdna
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4iqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iqva1 a.60.6.0 (A:148-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
mkdtegipclgdkvksiiegiiedgesseakavln

SCOPe Domain Coordinates for d4iqva1:

Click to download the PDB-style file with coordinates for d4iqva1.
(The format of our PDB-style files is described here.)

Timeline for d4iqva1: