Lineage for d4iqua2 (4iqu A:243-302)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1738431Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1738680Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. 1738681Protein automated matches [254483] (3 species)
    not a true protein
  7. 1738688Species Mouse (Mus musculus) [TaxId:10090] [255237] (29 PDB entries)
  8. 1738690Domain d4iqua2: 4iqu A:243-302 [252676]
    Other proteins in same PDB: d4iqua1, d4iqua3
    automated match to d1jmsa3
    complexed with 1fq, na

Details for d4iqua2

PDB Entry: 4iqu (more details), 2.4 Å

PDB Description: tdt core in complex with inhibitor (2z,5e)-6-[4-(4-fluorobenzoyl)-1h- pyrrol-2-yl]-2-hydroxy-4-oxohexa-2,5-dienoic acid
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4iqua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iqua2 a.60.12.0 (A:243-302) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

SCOPe Domain Coordinates for d4iqua2:

Click to download the PDB-style file with coordinates for d4iqua2.
(The format of our PDB-style files is described here.)

Timeline for d4iqua2: