Lineage for d4inut_ (4inu T:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (16 species)
    not a true protein
  7. 2554848Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2554868Domain d4inut_: 4inu T: [252661]
    Other proteins in same PDB: d4inua_, d4inub_, d4inue_, d4inug_, d4inuh_, d4inui_, d4inuj_, d4inuk_, d4inul_, d4inum_, d4inun_, d4inuo_, d4inup_, d4inus_, d4inuu_, d4inuv_, d4inuw_, d4inux_, d4inuy_, d4inuz_
    automated match to d1irug_
    complexed with 1g6

Details for d4inut_

PDB Entry: 4inu (more details), 3.1 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU112
PDB Compounds: (T:) Proteasome component C1

SCOPe Domain Sequences for d4inut_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inut_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d4inut_:

Click to download the PDB-style file with coordinates for d4inut_.
(The format of our PDB-style files is described here.)

Timeline for d4inut_: