SCOP 1.75: Domain d1hjpa3: 1hjp A:1-64

Lineage for d1hjpa3 (1hjp A:1-64)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
   barrel, closed; n=5, S=10

6. Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
   tetramer; binds Holliday junction

7. Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)

8. Domain d1hjpa3: 1hjp A:1-64 [25266]
   Other proteins in same PDB: d1hjpa1, d1hjpa2

Details for d1hjpa3

PDB Entry: 1hjp, 2.5 Å

PDB Description: holliday junction binding protein ruva from e. coli

PDB Compounds: (A:) ruva

SCOP Domain Sequences for d1hjpa3:

Sequence; same for both SEQRES and ATOM records:

>d1hjpa3 b.40.4.2 (A:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli [TaxId: 562]}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

Timeline for d1hjpa3:

• d1hjpa3 first appeared (with stable ids) in SCOP 1.55, called d1hjp_3
  
• d1hjpa3 appears in SCOP 1.73
  
• d1hjpa3 appears in SCOPe 2.01
  
• d1hjpa3 appears in the current release, SCOPe 2.08