Lineage for d4il8a4 (4il8 A:368-463)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538955Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2538994Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. 2538995Protein automated matches [254722] (3 species)
    not a true protein
  7. 2539009Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256305] (2 PDB entries)
  8. 2539011Domain d4il8a4: 4il8 A:368-463 [252643]
    Other proteins in same PDB: d4il8a1, d4il8a2, d4il8a3
    automated match to d1p5dx4
    complexed with gol, mg; mutant

Details for d4il8a4

PDB Entry: 4il8 (more details), 1.8 Å

PDB Description: crystal structure of an h329a mutant of p. aeruginosa pmm/pgm
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d4il8a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il8a4 d.129.2.0 (A:368-463) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOPe Domain Coordinates for d4il8a4:

Click to download the PDB-style file with coordinates for d4il8a4.
(The format of our PDB-style files is described here.)

Timeline for d4il8a4: