Lineage for d4il0a2 (4il0 A:137-445)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823858Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1823859Protein automated matches [226923] (71 species)
    not a true protein
  7. 1824108Species Escherichia coli [TaxId:511145] [256303] (1 PDB entry)
  8. 1824109Domain d4il0a2: 4il0 A:137-445 [252625]
    Other proteins in same PDB: d4il0a1, d4il0b1, d4il0c1, d4il0d1, d4il0e1, d4il0f1, d4il0g1, d4il0h1
    automated match to d3n6ha2
    complexed with cit, gol

Details for d4il0a2

PDB Entry: 4il0 (more details), 2.8 Å

PDB Description: Crystal structure of GlucDRP from E. coli K-12 MG1655 (EFI target EFI-506058)
PDB Compounds: (A:) Glucarate dehydratase-related protein

SCOPe Domain Sequences for d4il0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il0a2 c.1.11.0 (A:137-445) automated matches {Escherichia coli [TaxId: 511145]}
pgkqreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnseavvrlaeasqd
rygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeaislckglndvlt
yaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlnavdipladphfw
tlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaidthwiwqegdcr
ltqnpleikngkiavpdapglgveldweqvqkaheaykrlpggarndagpmqylipgwtf
drkrpvfgr

SCOPe Domain Coordinates for d4il0a2:

Click to download the PDB-style file with coordinates for d4il0a2.
(The format of our PDB-style files is described here.)

Timeline for d4il0a2: