SCOPe 2.08: Domain d4ig9g1: 4ig9 G:234-502

Lineage for d4ig9g1 (4ig9 G:234-502)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries)

8. Domain d4ig9g1: 4ig9 G:234-502 [252622]
   Other proteins in same PDB: d4ig9a2, d4ig9c2, d4ig9e2, d4ig9g2
   automated match to d1ma3a_
   complexed with zn

Details for d4ig9g1

PDB Entry: 4ig9, 2.64 Å

PDB Description: Structure of NAD-dependent protein deacetylase sirtuin-1 (open state, 2.64 A)

PDB Compounds: (G:) NAD-dependent protein deacetylase sirtuin-1

SCOPe Domain Sequences for d4ig9g1:

Sequence; same for both SEQRES and ATOM records:

>d4ig9g1 c.31.1.0 (G:234-502) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkrkdintiedavkllqeckkiivltgagvsvscgipdfrsrdgiyarlavdfpdlpdp
qamfdieyfrkdprpffkfakeiypgqfqpslchkfialsdkegkllrnytqnidtleqv
agiqriiqchgsfatasclickykvdceavrgdifnqvvprcprcpadeplaimkpeivf
fgenlpeqfhramkydkdevdllivigsslkvrpvalipssiphevpqilinreplphlh
fdvellgdcdviinelchrlggeyaklcc

Timeline for d4ig9g1:

• d4ig9g1 first appeared in SCOPe 2.04, called d4ig9g_
  
• d4ig9g1 appears in SCOPe 2.07