Lineage for d4id7a_ (4id7 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542373Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species)
    PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinase
  7. 2542374Species Human (Homo sapiens) [TaxId:9606] [111201] (9 PDB entries)
    Uniprot Q07912 117-389
  8. 2542385Domain d4id7a_: 4id7 A: [252613]
    automated match to d1u54a_
    complexed with 1g0, so4

Details for d4id7a_

PDB Entry: 4id7 (more details), 3 Å

PDB Description: ACK1 kinase in complex with the inhibitor cis-3-[8-amino-1-(4-phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol
PDB Compounds: (A:) Activated CDC42 kinase 1

SCOPe Domain Sequences for d4id7a_:

Sequence, based on SEQRES records: (download)

>d4id7a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
pqdiynvmvqcwahkpedrptfvalrdflleaq

Sequence, based on observed residues (ATOM records): (download)

>d4id7a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkppeamddfirevnam
hsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmg
yleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapes
lktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiy
nvmvqcwahkpedrptfvalrdflleaq

SCOPe Domain Coordinates for d4id7a_:

Click to download the PDB-style file with coordinates for d4id7a_.
(The format of our PDB-style files is described here.)

Timeline for d4id7a_: