SCOPe 2.05: Domain d4i78b_: 4i78 B:

Lineage for d4i78b_ (4i78 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (23 species)
   not a true protein

7. Species Influenza A virus [TaxId:1129347] [256297] (1 PDB entry)

8. Domain d4i78b_: 4i78 B: [252590]
   Other proteins in same PDB: d4i78c_, d4i78d_
   automated match to d3gbna_
   complexed with nag

Details for d4i78b_

PDB Entry: 4i78, 3.18 Å

PDB Description: crystal structure of a subtype h17 hemagglutinin homologue from a/little yellow-shouldered bat/guatemala/060/2010 (h17n10)

PDB Compounds: (B:) hemagglutinin HA1

SCOPe Domain Sequences for d4i78b_:

Sequence; same for both SEQRES and ATOM records:

>d4i78b_ b.19.1.0 (B:) automated matches {Influenza A virus [TaxId: 1129347]}
dricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlagw
llgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnpq
smtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntkd
aaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlries
tgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtignc
pkyvkatslmlatglrnnp

Timeline for d4i78b_:

• d4i78b_ first appeared in SCOPe 2.04
  
• d4i78b_ appears in SCOPe 2.06
  
• d4i78b_ appears in the current release, SCOPe 2.08