Lineage for d4i3rl2 (4i3r L:107-214)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517747Domain d4i3rl2: 4i3r L:107-214 [252587]
    Other proteins in same PDB: d4i3rl1
    automated match to d1dn0a2
    complexed with nag

Details for d4i3rl2

PDB Entry: 4i3r (more details), 3 Å

PDB Description: Crystal structure of the outer domain of HIV-1 gp120 in complex with VRC-PG04 space group P3221
PDB Compounds: (L:) Light chain of VRC-PG04 Fab

SCOPe Domain Sequences for d4i3rl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i3rl2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d4i3rl2:

Click to download the PDB-style file with coordinates for d4i3rl2.
(The format of our PDB-style files is described here.)

Timeline for d4i3rl2: