SCOPe 2.08: Domain d4i3fa1: 4i3f A:1-282

Lineage for d4i3fa1 (4i3f A:1-282)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Cycloclasticus sp. [TaxId:385025] [256296] (1 PDB entry)

8. Domain d4i3fa1: 4i3f A:1-282 [252585]
   Other proteins in same PDB: d4i3fa2
   automated match to d4lxga_
   complexed with cl, na, peg

Details for d4i3fa1

PDB Entry: 4i3f, 1.69 Å

PDB Description: Crystal structure of serine hydrolase CCSP0084 from the polyaromatic hydrocarbon (PAH)-degrading bacterium Cycloclasticus zankles

PDB Compounds: (A:) serine hydrolase CCSP0084

SCOPe Domain Sequences for d4i3fa1:

Sequence; same for both SEQRES and ATOM records:

>d4i3fa1 c.69.1.0 (A:1-282) automated matches {Cycloclasticus sp. [TaxId: 385025]}
mqtsniqtgsfntflneagtdkdtsilllhgsgpganamsnwqyalpflaenyhclapdi
agfglsqhncppngtshwidiwvqqqidlldakgieqthivgnsmgggvtlhllnrhper
fkkavlmgpvgapfaptegltkgwefykdpskealeylitkflfdpsllgndiasiaaqr
fdnvmkdevrlqfeamfsggtkkgidafvlsddelnnishqmlvtharedffiplnnayy
lidripnaqlhvfdhcghwvqiekkkafnnltklffdgmfdd

Timeline for d4i3fa1:

• d4i3fa1 first appeared in SCOPe 2.04, called d4i3fa_
  
• d4i3fa1 appears in SCOPe 2.07