Lineage for d4i2ia1 (4i2i A:148-242)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1737967Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1738192Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 1738193Protein automated matches [254482] (2 species)
    not a true protein
  7. 1738200Species Mouse (Mus musculus) [TaxId:10090] [255236] (29 PDB entries)
  8. 1738220Domain d4i2ia1: 4i2i A:148-242 [252579]
    Other proteins in same PDB: d4i2ia2, d4i2ia3
    automated match to d1jmsa1
    complexed with ap5, mg, zn

Details for d4i2ia1

PDB Entry: 4i2i (more details), 2.5 Å

PDB Description: binary complex of mouse tdt with ap5a
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4i2ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2ia1 a.60.6.0 (A:148-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
mkdtegipclgdkvksiiegiiedgesseakavln

SCOPe Domain Coordinates for d4i2ia1:

Click to download the PDB-style file with coordinates for d4i2ia1.
(The format of our PDB-style files is described here.)

Timeline for d4i2ia1: