Lineage for d4i2ha3 (4i2h A:303-510)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686016Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1686017Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1686025Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. Protein automated matches [254484] (3 species)
    not a true protein
  7. 1686261Species Mouse (Mus musculus) [TaxId:10090] [256295] (17 PDB entries)
  8. 1686278Domain d4i2ha3: 4i2h A:303-510 [252578]
    Other proteins in same PDB: d4i2ha1, d4i2ha2
    automated match to d1jmsa4
    protein/DNA complex; complexed with apc, mg, na, zn

Details for d4i2ha3

PDB Entry: 4i2h (more details), 2.75 Å

PDB Description: ternary complex of mouse tdt with ssdna and ampcpp
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4i2ha3:

Sequence, based on SEQRES records: (download)

>d4i2ha3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhseksgq
qegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtk
rvfleaeseeeifahlgldyiepwerna

Sequence, based on observed residues (ATOM records): (download)

>d4i2ha3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdiledhfqkcflilkldhgrvhsegkgwkairvdlvmcpydrra
fallgwtgsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyie
pwerna

SCOPe Domain Coordinates for d4i2ha3:

Click to download the PDB-style file with coordinates for d4i2ha3.
(The format of our PDB-style files is described here.)

Timeline for d4i2ha3: