![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins) insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain |
![]() | Protein automated matches [254484] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [256295] (30 PDB entries) |
![]() | Domain d4i2ha3: 4i2h A:303-510 [252578] Other proteins in same PDB: d4i2ha1, d4i2ha2 automated match to d1jmsa4 protein/DNA complex; complexed with apc, mg, na, zn |
PDB Entry: 4i2h (more details), 2.75 Å
SCOPe Domain Sequences for d4i2ha3:
Sequence, based on SEQRES records: (download)
>d4i2ha3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhseksgq qegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtk rvfleaeseeeifahlgldyiepwerna
>d4i2ha3 d.218.1.2 (A:303-510) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll hkvtdfwkqqglllycdiledhfqkcflilkldhgrvhsegkgwkairvdlvmcpydrra fallgwtgsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyie pwerna
Timeline for d4i2ha3: