![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.0: automated matches [254215] (1 protein) not a true family |
![]() | Protein automated matches [254483] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255237] (29 PDB entries) |
![]() | Domain d4i2ha2: 4i2h A:243-302 [252577] Other proteins in same PDB: d4i2ha1, d4i2ha3 automated match to d1jmsa3 protein/DNA complex; complexed with apc, mg, na, zn |
PDB Entry: 4i2h (more details), 2.75 Å
SCOPe Domain Sequences for d4i2ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i2ha2 a.60.12.0 (A:243-302) automated matches {Mouse (Mus musculus) [TaxId: 10090]} deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc
Timeline for d4i2ha2: