SCOPe 2.04: Domain d4i2ga1: 4i2g A:149-242

Lineage for d4i2ga1 (4i2g A:149-242)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.0: automated matches [254214] (1 protein)
   not a true family

6. Protein automated matches [254482] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255236] (18 PDB entries)

8. Domain d4i2ga1: 4i2g A:149-242 [252573]
   Other proteins in same PDB: d4i2ga2, d4i2ga3
   automated match to d1jmsa1
   protein/DNA complex; complexed with co, mg, na

Details for d4i2ga1

PDB Entry: 4i2g, 2.5 Å

PDB Description: binary complex of mouse tdt with ssdna

PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4i2ga1:

Sequence; same for both SEQRES and ATOM records:

>d4i2ga1 a.60.6.0 (A:149-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpitsm
kdtegipclgdkvksiiegiiedgesseakavln

Timeline for d4i2ga1:

• d4i2ga1 is new in SCOPe 2.04-stable
  
• d4i2ga1 appears in SCOPe 2.05
  
• d4i2ga1 appears in the current release, SCOPe 2.08