Lineage for d4i2da1 (4i2d A:149-242)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001491Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2001718Family a.60.6.0: automated matches [254214] (1 protein)
    not a true family
  6. 2001719Protein automated matches [254482] (3 species)
    not a true protein
  7. 2001726Species Mouse (Mus musculus) [TaxId:10090] [255236] (29 PDB entries)
  8. 2001741Domain d4i2da1: 4i2d A:149-242 [252564]
    Other proteins in same PDB: d4i2da2, d4i2da3
    automated match to d1jmsa1
    complexed with apc, mg, na, zn

Details for d4i2da1

PDB Entry: 4i2d (more details), 2.3 Å

PDB Description: binary complex of mouse tdt with ampcpp
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4i2da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2da1 a.60.6.0 (A:149-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpitsm
kdtegipclgdkvksiiegiiedgesseakavln

SCOPe Domain Coordinates for d4i2da1:

Click to download the PDB-style file with coordinates for d4i2da1.
(The format of our PDB-style files is described here.)

Timeline for d4i2da1: