![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255237] (18 PDB entries) |
![]() | Domain d4i28a2: 4i28 A:243-302 [252550] Other proteins in same PDB: d4i28a1, d4i28a3 automated match to d1jmsa3 protein/DNA complex; complexed with mg, na, zn |
PDB Entry: 4i28 (more details), 2.15 Å
SCOPe Domain Sequences for d4i28a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i28a2 a.60.12.0 (A:243-302) automated matches {Mouse (Mus musculus) [TaxId: 10090]} deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc
Timeline for d4i28a2: