![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.0: automated matches [254214] (1 protein) not a true family |
![]() | Protein automated matches [254482] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255236] (31 PDB entries) |
![]() | Domain d4i27a1: 4i27 A:146-242 [252546] Other proteins in same PDB: d4i27a2, d4i27a3 automated match to d1jmsa1 protein/DNA complex; complexed with d3t, mg, na |
PDB Entry: 4i27 (more details), 2.6 Å
SCOPe Domain Sequences for d4i27a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i27a1 a.60.6.0 (A:146-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avkkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpi tsmkdtegipclgdkvksiiegiiedgesseakavln
Timeline for d4i27a1: