Lineage for d4huwe2 (4huw E:182-277)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026191Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2026491Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
    Uniprot P01901 22-299
  8. 2026646Domain d4huwe2: 4huw E:182-277 [252513]
    Other proteins in same PDB: d4huwa1, d4huwb1, d4huwb2, d4huwc1, d4huwd1, d4huwd2, d4huwe1, d4huwf1, d4huwf2, d4huwg1, d4huwh1, d4huwh2
    automated match to d1fo0h1
    complexed with so4

Details for d4huwe2

PDB Entry: 4huw (more details), 3.16 Å

PDB Description: crystal structure of h2db-npm6t
PDB Compounds: (E:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4huwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4huwe2 b.1.1.2 (E:182-277) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwepp

SCOPe Domain Coordinates for d4huwe2:

Click to download the PDB-style file with coordinates for d4huwe2.
(The format of our PDB-style files is described here.)

Timeline for d4huwe2: