Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries) Uniprot P01901 22-299 |
Domain d4huwa2: 4huw A:182-277 [252507] Other proteins in same PDB: d4huwa1, d4huwb_, d4huwc1, d4huwd_, d4huwe1, d4huwf_, d4huwg1, d4huwh_ automated match to d1fo0h1 complexed with so4 |
PDB Entry: 4huw (more details), 3.16 Å
SCOPe Domain Sequences for d4huwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4huwa2 b.1.1.2 (A:182-277) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrwepp
Timeline for d4huwa2: