SCOPe 2.08: Domain d4htaa1: 4hta A:2-268

Lineage for d4htaa1 (4hta A:2-268)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (22 PDB entries)

8. Domain d4htaa1: 4hta A:2-268 [252501]
   Other proteins in same PDB: d4htaa2
   automated match to d1woma_
   complexed with gol, po4

Details for d4htaa1

PDB Entry: 4hta, 1.9 Å

PDB Description: The structure of the karrikin insensitive (KAI2) protein in Arabidopsis thaliana

PDB Compounds: (A:) Hydrolase, alpha/beta fold family protein

SCOPe Domain Sequences for d4htaa1:

Sequence; same for both SEQRES and ATOM records:

>d4htaa1 c.69.1.0 (A:2-268) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdy
fdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisas
pryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnm
rpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevi
psdghlpqlsspdsvipvilrhirndi

Timeline for d4htaa1:

• d4htaa1 first appeared in SCOPe 2.04, called d4htaa_
  
• d4htaa1 appears in SCOPe 2.07