SCOPe 2.06: Domain d4hrya_: 4hry A:

Lineage for d4hrya_ (4hry A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (9 PDB entries)

8. Domain d4hrya_: 4hry A: [252493]
   automated match to d1woma_
   complexed with cl, gol, na, po4, tam

Details for d4hrya_

PDB Entry: 4hry, 1.5 Å

PDB Description: The structure of Arabidopsis thaliana KAI2

PDB Compounds: (A:) Hydrolase, alpha/beta fold family protein

SCOPe Domain Sequences for d4hrya_:

Sequence; same for both SEQRES and ATOM records:

>d4hrya_ c.69.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdy
fdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisas
pryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnm
rpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevi
psdghlpqlsspdsvipvilrhirndia

Timeline for d4hrya_:

• d4hrya_ first appeared in SCOPe 2.04
  
• d4hrya_ appears in SCOPe 2.05
  
• d4hrya_ appears in SCOPe 2.07
  
• d4hrya_ appears in the current release, SCOPe 2.08