Lineage for d4hlea4 (4hle A:726-1092)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (28 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1032 PDB entries)
  8. 2547354Domain d4hlea4: 4hle A:726-1092 [252466]
    Other proteins in same PDB: d4hlea1, d4hlea2, d4hlea3
    automated match to d1e7ua4
    complexed with 17v

Details for d4hlea4

PDB Entry: 4hle (more details), 2.78 Å

PDB Description: Compound 21 (1-alkyl-substituted 1,2,4-triazoles)
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4hlea4:

Sequence, based on SEQRES records: (download)

>d4hlea4 d.144.1.0 (A:726-1092) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wflhlvl

Sequence, based on observed residues (ATOM records): (download)

>d4hlea4 d.144.1.0 (A:726-1092) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslydvssqvisqlkqklenlqnsqlpesfrvpydp
glkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilr
imesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnh
wlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghir
vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvl

SCOPe Domain Coordinates for d4hlea4:

Click to download the PDB-style file with coordinates for d4hlea4.
(The format of our PDB-style files is described here.)

Timeline for d4hlea4: