Class a: All alpha proteins [46456] (285 folds) |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (23 PDB entries) |
Domain d4hlea3: 4hle A:528-725 [252465] Other proteins in same PDB: d4hlea1, d4hlea2, d4hlea4 automated match to d1e7ua1 complexed with 17v |
PDB Entry: 4hle (more details), 2.78 Å
SCOPe Domain Sequences for d4hlea3:
Sequence, based on SEQRES records: (download)
>d4hlea3 a.118.1.0 (A:528-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} alpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpk aypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqk lesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsr hyqqrfavileaylrgcg
>d4hlea3 a.118.1.0 (A:528-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} alpkempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqq eivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyll qlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileayl rgcg
Timeline for d4hlea3: