Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (29 species) not a true protein |
Species Toxascaris leonina [TaxId:59264] [256287] (1 PDB entry) |
Domain d4hl0b2: 4hl0 B:145-278 [252460] automated match to d3i8ta_ |
PDB Entry: 4hl0 (more details), 2 Å
SCOPe Domain Sequences for d4hl0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hl0b2 b.29.1.0 (B:145-278) automated matches {Toxascaris leonina [TaxId: 59264]} yypvpyesglagdglapgksllifatpekkgkrfhinllkkngdialhfnprfdekaivr nslisgewgneeregknplekgigcdlefrneeyafqiyvdgerfatyahrldphdingl qiggdvevtgiqmv
Timeline for d4hl0b2: