Lineage for d4hgka1 (4hgk A:4-196)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1503613Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1503614Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1503945Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 1503946Protein automated matches [254493] (5 species)
    not a true protein
  7. 1503988Species Human (Homo sapiens) [TaxId:9606] [255068] (15 PDB entries)
  8. 1504028Domain d4hgka1: 4hgk A:4-196 [252442]
    Other proteins in same PDB: d4hgkc_, d4hgkd_
    automated match to d3jrya1

Details for d4hgka1

PDB Entry: 4hgk (more details), 3.04 Å

PDB Description: Shark IgNAR variable domain
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4hgka1:

Sequence, based on SEQRES records: (download)

>d4hgka1 a.126.1.0 (A:4-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd
kslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvm
ctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkld
elrdegkassakq

Sequence, based on observed residues (ATOM records): (download)

>d4hgka1 a.126.1.0 (A:4-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd
kslhtlfgdklctvatlgemadccakqepernecflqhkddnpnlprlvrpevdvmctaf
hdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkldelrd
egkassakq

SCOPe Domain Coordinates for d4hgka1:

Click to download the PDB-style file with coordinates for d4hgka1.
(The format of our PDB-style files is described here.)

Timeline for d4hgka1: