Lineage for d4hfub_ (4hfu B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (125 PDB entries)
  8. 2592000Domain d4hfub_: 4hfu B: [252437]
    Other proteins in same PDB: d4hfua1, d4hfua2, d4hful1, d4hful2
    automated match to d2viub_
    complexed with nag

Details for d4hfub_

PDB Entry: 4hfu (more details), 3.11 Å

PDB Description: crystal structure of fab 8m2 in complex with a h2n2 influenza virus hemagglutinin
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4hfub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hfub_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsndqgsgyaadkestqkafdgitnkvnsviekmn
tqfeavgkefsnlerrlenlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrmqlrdnvkelgngcfefyhkcddecmnsvkngtydypkyeeesklnrne

SCOPe Domain Coordinates for d4hfub_:

Click to download the PDB-style file with coordinates for d4hfub_.
(The format of our PDB-style files is described here.)

Timeline for d4hfub_: