Lineage for d4hd6b_ (4hd6 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740883Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 1740884Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 1740950Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 1740951Protein automated matches [254708] (1 species)
    not a true protein
  7. 1740952Species Bacillus megaterium [TaxId:1404] [255981] (15 PDB entries)
  8. 1740958Domain d4hd6b_: 4hd6 B: [252419]
    automated match to d2ahka_
    complexed with cu; mutant

Details for d4hd6b_

PDB Entry: 4hd6 (more details), 2 Å

PDB Description: Crystal Structure of Tyrosinase from Bacillus megaterium V218F mutant soaked in CuSO4
PDB Compounds: (B:) tyrosinase

SCOPe Domain Sequences for d4hd6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hd6b_ a.86.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvfptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydie

SCOPe Domain Coordinates for d4hd6b_:

Click to download the PDB-style file with coordinates for d4hd6b_.
(The format of our PDB-style files is described here.)

Timeline for d4hd6b_: