Lineage for d4h27a_ (4h27 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2156900Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2157154Protein automated matches [190054] (13 species)
    not a true protein
  7. 2157181Species Human (Homo sapiens) [TaxId:9606] [256281] (1 PDB entry)
  8. 2157182Domain d4h27a_: 4h27 A: [252369]
    automated match to d1pwha_
    complexed with so4

Details for d4h27a_

PDB Entry: 4h27 (more details), 1.3 Å

PDB Description: Modulating the function of human serine racemase and human serine dehydratase by protein engineering
PDB Compounds: (A:) L-serine dehydratase/L-threonine deaminase

SCOPe Domain Sequences for d4h27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h27a_ c.79.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eplhvktpirdsmalskmagtsvylkmdsaqpsgsfkirgighfckrwakqgcahfvcss
sgnagmaaayaarqlgvpativvpgttpaltierlknegatvkvvgelldeafelakala
knnpgwvyippfddpliweghasivkelketlwekpgaialsvggggllcgvvqglqevg
wgdvpviametfgahsfhaattagklvslpkitsvakalgvktvgaqalklfqehpifse
visdqeavaaiekfvddekilvepacgaalaavyshviqklqlegnlrtplpslvvivcg
gsnislaqlralkeqlgm

SCOPe Domain Coordinates for d4h27a_:

Click to download the PDB-style file with coordinates for d4h27a_.
(The format of our PDB-style files is described here.)

Timeline for d4h27a_: