Class b: All beta proteins [48724] (177 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein automated matches [190874] (7 species) not a true protein |
Species Mastigocladus laminosus [TaxId:83541] [255132] (4 PDB entries) |
Domain d4h13d2: 4h13 D:46-179 [252358] Other proteins in same PDB: d4h13a_, d4h13b_, d4h13d1, d4h13f_, d4h13g_, d4h13h_ automated match to d1vf5d1 complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq |
PDB Entry: 4h13 (more details), 3.07 Å
SCOPe Domain Sequences for d4h13d2:
Sequence, based on SEQRES records: (download)
>d4h13d2 b.33.1.1 (D:46-179) automated matches {Mastigocladus laminosus [TaxId: 83541]} sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin avcthlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpw tetdfrtgekpwwv
>d4h13d2 b.33.1.1 (D:46-179) automated matches {Mastigocladus laminosus [TaxId: 83541]} sggavttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdyginavc thlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtet dfrtgekpwwv
Timeline for d4h13d2: