Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) |
Family f.23.12.0: automated matches [254198] (1 protein) not a true family |
Protein automated matches [254432] (4 species) not a true protein |
Species Mastigocladus laminosus [TaxId:83541] [255131] (4 PDB entries) |
Domain d4h13d1: 4h13 D:9-45 [252357] Other proteins in same PDB: d4h13a_, d4h13b_, d4h13d2, d4h13f_, d4h13g_, d4h13h_ automated match to d2e76d2 complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, tds, umq |
PDB Entry: 4h13 (more details), 3.07 Å
SCOPe Domain Sequences for d4h13d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h13d1 f.23.12.0 (D:9-45) automated matches {Mastigocladus laminosus [TaxId: 83541]} dvpdmgrrqfmnllafgtvtgvalgalyplvkyfipp
Timeline for d4h13d1: