Lineage for d4h0ca_ (4h0c A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871148Species Dyadobacter fermentans [TaxId:471854] [256280] (1 PDB entry)
  8. 1871149Domain d4h0ca_: 4h0c A: [252353]
    automated match to d3u0va_
    complexed with cit, gol, na

Details for d4h0ca_

PDB Entry: 4h0c (more details), 1.62 Å

PDB Description: Crystal structure of phospholipase/Carboxylesterase from Dyadobacter fermentans DSM 18053
PDB Compounds: (A:) Phospholipase/Carboxylesterase

SCOPe Domain Sequences for d4h0ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0ca_ c.69.1.0 (A:) automated matches {Dyadobacter fermentans [TaxId: 471854]}
snamythskqiitsgvpvqrakkavvmlhgrggtaadiislqkvlkldemaiyapqatnn
swypysfmapvqqnqpaldsalalvgevvaeieaqgipaeqiyfagfsqgacltleyttr
narkyggiiaftggligqelaignykgdfkqtpvfistgnpdphvpvsrvqesvtiledm
naavsqvvypgrphtisgdeiqlvnntilk

SCOPe Domain Coordinates for d4h0ca_:

Click to download the PDB-style file with coordinates for d4h0ca_.
(The format of our PDB-style files is described here.)

Timeline for d4h0ca_: