Lineage for d4gwfb1 (4gwf B:3-110)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1919172Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1919173Protein automated matches [190561] (3 species)
    not a true protein
  7. 1919174Species Human (Homo sapiens) [TaxId:9606] [187549] (41 PDB entries)
  8. 1919182Domain d4gwfb1: 4gwf B:3-110 [252340]
    Other proteins in same PDB: d4gwfa3, d4gwfb3
    automated match to d2shpa2
    complexed with edo, gol, peg, pge; mutant

Details for d4gwfb1

PDB Entry: 4gwf (more details), 2.1 Å

PDB Description: crystal structure of the tyrosine phosphatase shp-2 with y279c mutation
PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4gwfb1:

Sequence, based on SEQRES records: (download)

>d4gwfb1 d.93.1.0 (B:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

Sequence, based on observed residues (ATOM records): (download)

>d4gwfb1 d.93.1.0 (B:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlvielkyplncadptse

SCOPe Domain Coordinates for d4gwfb1:

Click to download the PDB-style file with coordinates for d4gwfb1.
(The format of our PDB-style files is described here.)

Timeline for d4gwfb1: