Lineage for d1fnwh1 (1fnw H:2101-2207)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398572Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2398677Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 2398678Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
    Uniprot P08095
  8. 2398710Domain d1fnwh1: 1fnw H:2101-2207 [25231]
    Other proteins in same PDB: d1fnwa2, d1fnwb2, d1fnwc2, d1fnwd2, d1fnwe2, d1fnwf2, d1fnwg2, d1fnwh2
    complexed with cd

Details for d1fnwh1

PDB Entry: 1fnw (more details), 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a
PDB Compounds: (H:) exotoxin type a precursor (allele 1)

SCOPe Domain Sequences for d1fnwh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnwh1 b.40.2.2 (H:2101-2207) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOPe Domain Coordinates for d1fnwh1:

Click to download the PDB-style file with coordinates for d1fnwh1.
(The format of our PDB-style files is described here.)

Timeline for d1fnwh1: