SCOP 1.57: Domain d1fnwe1: 1fnw E:1201-1307

Lineage for d1fnwe1 (1fnw E:1201-1307)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50241] (4 PDB entries)

8. Domain d1fnwe1: 1fnw E:1201-1307 [25228]
   Other proteins in same PDB: d1fnwa2, d1fnwb2, d1fnwc2, d1fnwd2, d1fnwe2, d1fnwf2, d1fnwg2, d1fnwh2

Details for d1fnwe1

PDB Entry: 1fnw, 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnwe1:

Sequence; same for both SEQRES and ATOM records:

>d1fnwe1 b.40.2.2 (E:1201-1307) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

Timeline for d1fnwe1:

• d1fnwe1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnwe1 appears in SCOP 1.59
  
• d1fnwe1 appears in the current release, SCOPe 2.08