Lineage for d1fnwb1 (1fnw B:301-407)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110417Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 110465Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 110466Species Streptococcus pyogenes [TaxId:1314] [50241] (4 PDB entries)
  8. 110480Domain d1fnwb1: 1fnw B:301-407 [25225]
    Other proteins in same PDB: d1fnwa2, d1fnwb2, d1fnwc2, d1fnwd2, d1fnwe2, d1fnwf2, d1fnwg2, d1fnwh2

Details for d1fnwb1

PDB Entry: 1fnw (more details), 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnwb1 b.40.2.2 (B:301-407) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnwb1:

Click to download the PDB-style file with coordinates for d1fnwb1.
(The format of our PDB-style files is described here.)

Timeline for d1fnwb1: