Lineage for d1fnvd1 (1fnv D:901-1007)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059173Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 2059174Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
    Uniprot P08095
  8. 2059198Domain d1fnvd1: 1fnv D:901-1007 [25223]
    Other proteins in same PDB: d1fnva2, d1fnvb2, d1fnvc2, d1fnvd2
    complexed with cd

Details for d1fnvd1

PDB Entry: 1fnv (more details), 3.6 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a
PDB Compounds: (D:) exotoxin type a precursor (allele 1)

SCOPe Domain Sequences for d1fnvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnvd1 b.40.2.2 (D:901-1007) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOPe Domain Coordinates for d1fnvd1:

Click to download the PDB-style file with coordinates for d1fnvd1.
(The format of our PDB-style files is described here.)

Timeline for d1fnvd1: