Lineage for d1fnvb1 (1fnv B:301-407)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 297207Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 297262Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 297263Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)
  8. 297281Domain d1fnvb1: 1fnv B:301-407 [25221]
    Other proteins in same PDB: d1fnva2, d1fnvb2, d1fnvc2, d1fnvd2

Details for d1fnvb1

PDB Entry: 1fnv (more details), 3.6 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnvb1 b.40.2.2 (B:301-407) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnvb1:

Click to download the PDB-style file with coordinates for d1fnvb1.
(The format of our PDB-style files is described here.)

Timeline for d1fnvb1: