Lineage for d1fnvb1 (1fnv B:301-407)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59304Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 59350Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 59351Species Streptococcus pyogenes [TaxId:1314] [50241] (4 PDB entries)
  8. 59361Domain d1fnvb1: 1fnv B:301-407 [25221]
    Other proteins in same PDB: d1fnva2, d1fnvb2, d1fnvc2, d1fnvd2

Details for d1fnvb1

PDB Entry: 1fnv (more details), 3.6 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnvb1 b.40.2.2 (B:301-407) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnvb1:

Click to download the PDB-style file with coordinates for d1fnvb1.
(The format of our PDB-style files is described here.)

Timeline for d1fnvb1: