Lineage for d4gcvl_ (4gcv L:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722860Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1722861Protein automated matches [190154] (57 species)
    not a true protein
  7. 1723140Species Pseudomonas aeruginosa [TaxId:208964] [256270] (1 PDB entry)
  8. 1723152Domain d4gcvl_: 4gcv L: [252202]
    automated match to d2f2eb_
    complexed with gol, na, po4

Details for d4gcvl_

PDB Entry: 4gcv (more details), 2.3 Å

PDB Description: Structure of a Putative transcription factor (PA1374)from Pseudomonas aeruginosa
PDB Compounds: (L:) Putative transcription protein

SCOPe Domain Sequences for d4gcvl_:

Sequence, based on SEQRES records: (download)

>d4gcvl_ a.4.5.0 (L:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
ysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaala
dgrtvpleqctvqagpaaseemrqrl

Sequence, based on observed residues (ATOM records): (download)

>d4gcvl_ a.4.5.0 (L:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
cpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnalveagllerqp
ysyqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgrpvrsfmaaladgrtv
pleqctvqagpaaseemrqrl

SCOPe Domain Coordinates for d4gcvl_:

Click to download the PDB-style file with coordinates for d4gcvl_.
(The format of our PDB-style files is described here.)

Timeline for d4gcvl_: