Lineage for d1b1zd1 (1b1z D:3-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 297207Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 297262Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 297263Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)
  8. 297271Domain d1b1zd1: 1b1z D:3-107 [25219]
    Other proteins in same PDB: d1b1za2, d1b1zb2, d1b1zc2, d1b1zd2

Details for d1b1zd1

PDB Entry: 1b1z (more details), 2.57 Å

PDB Description: streptococcal pyrogenic exotoxin a1

SCOP Domain Sequences for d1b1zd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1zd1 b.40.2.2 (D:3-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1b1zd1:

Click to download the PDB-style file with coordinates for d1b1zd1.
(The format of our PDB-style files is described here.)

Timeline for d1b1zd1: