Lineage for d4gb9a3 (4gb9 A:525-725)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725640Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 2725641Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2725642Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries)
  8. 2725644Domain d4gb9a3: 4gb9 A:525-725 [252187]
    Other proteins in same PDB: d4gb9a1, d4gb9a2, d4gb9a4, d4gb9a5
    automated match to d1e7ua1
    complexed with 0wr

Details for d4gb9a3

PDB Entry: 4gb9 (more details), 2.44 Å

PDB Description: Potent and Highly Selective Benzimidazole Inhibitors of PI3K-delta
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4gb9a3:

Sequence, based on SEQRES records: (download)

>d4gb9a3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d4gb9a3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpiaaempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgq
qeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyl
lqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileay
lrgcg

SCOPe Domain Coordinates for d4gb9a3:

Click to download the PDB-style file with coordinates for d4gb9a3.
(The format of our PDB-style files is described here.)

Timeline for d4gb9a3: