SCOPe 2.08: Domain d4gaab3: 4gaa B:458-606

Lineage for d4gaab3 (4gaa B:458-606)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (14 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [256268] (1 PDB entry)

8. Domain d4gaab3: 4gaa B:458-606 [252172]
   Other proteins in same PDB: d4gaaa1, d4gaaa2, d4gaab1, d4gaab2
   automated match to d3fh8a3
   complexed with bes, zn

Details for d4gaab3

PDB Entry: 4gaa, 2.26 Å

PDB Description: Structure of Leukotriene A4 hydrolase from Xenopus laevis complexed with inhibitor bestatin

PDB Compounds: (B:) MGC78867 protein

SCOPe Domain Sequences for d4gaab3:

Sequence; same for both SEQRES and ATOM records:

>d4gaab3 a.118.1.0 (B:458-606) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dmtlanacitlgqkwvkatesdlgsfsaddvkdlsshqlievlailllekplpvshvkrm
qevynlndvknseirfrwlrlciragwedviplalamateqgrmkftrplyrdlynfeka
reqtvntflknrsfmhpvtemlvakdlhi

Timeline for d4gaab3:

• d4gaab3 first appeared in SCOPe 2.04
  
• d4gaab3 appears in SCOPe 2.07