Lineage for d1b1zb1 (1b1z B:3-107)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166605Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 166656Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 166657Species Streptococcus pyogenes [TaxId:1314] [50241] (7 PDB entries)
  8. 166663Domain d1b1zb1: 1b1z B:3-107 [25217]
    Other proteins in same PDB: d1b1za2, d1b1zb2, d1b1zc2, d1b1zd2

Details for d1b1zb1

PDB Entry: 1b1z (more details), 2.57 Å

PDB Description: streptococcal pyrogenic exotoxin a1

SCOP Domain Sequences for d1b1zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1zb1 b.40.2.2 (B:3-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1b1zb1:

Click to download the PDB-style file with coordinates for d1b1zb1.
(The format of our PDB-style files is described here.)

Timeline for d1b1zb1: